General Information

  • ID:  hor006523
  • Uniprot ID:  P01185
  • Protein name:  Copeptin
  • Gene name:  AVP
  • Organism:  Homo sapiens (Human)
  • Family:  Vasopressin/oxytocin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with AVP include Diabetes Insipidus, Neurohypophyseal and Hereditary Central Diabetes Insipidus.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004672 protein kinase activity; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031894 V1A vasopressin receptor binding; GO:0031895 V1B vasopressin receptor binding; GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
  • GO BP:  GO:0002125 maternal aggressive behavior; GO:0003084 positive regulation of systemic arterial blood pressure; GO:0006091 generation of precursor metabolites and energy; GO:0006833 water transport; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007267 cell-cell signaling; GO:0007621 negative regulation of female receptivity; GO:0007625 grooming behavior; GO:0007626 locomotory behavior; GO:0008284 positive regulation of cell population proliferation; GO:0010628 positive regulation of gene expression; GO:0014049 positive regulation of glutamate secretion; GO:0014070 response to organic cyclic compound; GO:0030307 positive regulation of cell growth; GO:0031394 positive regulation of prostaglandin biosynthetic process; GO:0032849 positive regulation of cellular pH reduction; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0033574 response to testosterone; GO:0035094 response to nicotine; GO:0035176 social behavior; GO:0042310 vasoconstriction; GO:0042711 maternal behavior; GO:0043066 negative regulation of apoptotic process; GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process; GO:0045471 response to ethanol; GO:0045907 positive regulation of vasoconstriction; GO:0046718 symbiont entry into host cell; GO:0050891 multicellular organismal-level water homeostasis; GO:0051970 negative regulation of transmission of nerve impulse; GO:0070371 ERK1 and ERK2 cascade; GO:0070528 protein kinase C signaling; GO:0090201 negative regulation of release of cytochrome c from mitochondria; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol; GO:0030141 secretory granule; GO:0030425 dendrite; GO:0030669 clathrin-coated endocytic vesicle membrane; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
  • Length:  39
  • Propeptide:  MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
  • Signal peptide:  MPDTMLPACFLGLLAFSSA
  • Modification:  NA
  • Glycosylation:  T6 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  [Neurophysin 2]: Specifically binds vasopressin.; [Arg-vasopressin]: Has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (PubMed:18174156).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:  P30518, P37288
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01185-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006523_AF2.pdbhor006523_ESM.pdb

Physical Information

Mass: 469947 Formula: C177H279N49O58
Absent amino acids: CHIKMW Common amino acids: A
pI: 3.92 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 16
Hydrophobicity: -23.33 Boman Index: -4855
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 87.95
Instability Index: 5482.05 Extinction Coefficient cystines: 1490
Absorbance 280nm: 39.21

Literature

  • PubMed ID:  2991279
  • Title:  The human vasopressin gene is linked to the oxytocin gene and is selectively expressed in a cultured lung cancer cell line.
  • PubMed ID:  3768139
  • Title:  The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
  • PubMed ID:  4065330
  • Title:  Expression of the vasopressin and oxytocin genes in human hypothalami.
  • PubMed ID:  1740104
  • Title:  A missense mutation in the vasopressin-neurophysin precursor gene cosegregates with human autosomal dominant neurohypophyseal diabetes insipidus.
  • PubMed ID:  11780052
  • Title:  The DNA sequence and comparative analysis of human chromosome 20.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  13591312
  • Title:  On the nature of oxytocin and vasopressin from human pituitary.
  • PubMed ID:  6574452
  • Title:  Identification of human neurophysins: complete amino acid sequences of MSEL- and VLDV-neurophysins.
  • PubMed ID:  7271787
  • Title:  The complete sequence of a novel human pituitary glycopeptide homologous to pig posterior pituitary glycopeptide.
  • PubMed ID:  33713620
  • Title:  Soluble ACE2-mediated cell entry of SARS-CoV-2 via interaction with proteins related to the renin-angiotensin system.
  • PubMed ID:  8370682
  • Title:  Familial neurohypophyseal diabetes insipidus associated with a signal peptide mutation.
  • PubMed ID:  8103767
  • Title:  Glu-47, which forms a salt bridge between neurophysin-II and arginine vasopressin, is deleted in patients with familial central diabetes insipidus.
  • PubMed ID:  8514868
  • Title:  Possible involvement of inefficient cleavage of preprovasopressin by signal peptidase as a cause for familial central diabetes insipidus.
  • PubMed ID:  8045958
  • Title:  A de novo mutation in the coding sequence for neurophysin-II (Pro24-->Leu) is associated with onset and transmission of autosomal dominant neurohypophyseal diabetes insipidus.
  • PubMed ID:  7714110
  • Title:  Two novel mutations in the coding region for neurophysin-II associated with familial central diabetes insipidus.
  • PubMed ID:  8554046
  • Title:  Identification of 13 new mutations in the vasopressin-neurophysin II gene in 17 kindreds with familial autosomal dominant neurohypophyseal diabetes insipidus.
  • PubMed ID:  9360520
  • Title:  Autosomal dominant neurohypophyseal diabetes insipidus associated with a missense mutation encoding Gly23-->Val in neurophysin II.
  • PubMed ID:  9580132
  • Title:  Identification of a novel nonsense mutation and a missense substitution in the vasopressin-neurophysin II gene in two Spanish kindreds with familial neurohypophyseal diabetes insipidus.
  • PubMed ID:  9814475
  • Title:  Two novel mutations of the vasopressin gene associated with familial diabetes insipidus and identification of an asymptomatic carrier infant.
  • PubMed ID:  10369876
  • Title:  Autosomal recessive familial neurohypophyseal diabetes insipidus with continued secretion of mutant weakly active vasopressin.
  • PubMed ID:  10487710
  • Title:  Molecular analysis in familial neurohypophyseal diabetes insipidus: early diagnosis of an asymptomatic carr
  • PubMed ID:  11017955
  • Title:  
  • PubMed ID:  11150885
  • Title:  
  • PubMed ID:  10677561
  • Title:  
  • PubMed ID:  11748489
  • Title:  
  • PubMed ID:  11443218
  • Title:  
  • PubMed ID:  11161827
  • Title:  
  • PubMed ID:  
  • Title:  
    • Leu) is associated with onset and transmission of autosomal dominant neurohypophyseal diabetes insipidus.##Two novel mutations in the coding region for neurophysin-II associated with familial central diabetes insipidus.##Identification of 13 new mutations in the vasopressin-neurophysin II gene in 17 kindreds with familial autosomal dominant neurohypophyseal diabetes insipidus.##Autosomal dominant neurohypophyseal diabetes insipidus associated with a missense mutation encoding Gly23-->Val in neurophysin II.##Identification of a novel nonsense mutation and a missense substitution in the vasopressin-neurophysin II gene in two Spanish kindreds with familial neurohypophyseal diabetes insipidus.##Two novel mutations of the vasopressin gene associated with familial diabetes insipidus and identification of an asymptomatic carrier infant.##Autosomal recessive familial neurohypophyseal diabetes insipidus with continued secretion of mutant weakly active vasopressin.##Molecular analysis in familial neurohypophyseal diabetes insipidus: early diagnosis of an asymptomatic carr -->